Recombinant Human SH3GL2 protein (ab116741)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99962
    • SpeciesHuman
    • SequenceMSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEI MTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKF GRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKD LREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESS MFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQ PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL PH
    • Molecular weight65 kDa including tags
    • Amino acids1 to 352

Specifications

Our Abpromise guarantee covers the use of ab116741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • bA335L15.1 (SH3 domain GRB2 like 2)
    • CNSA2
    • EEN B1
    • EEN-B1
    • Endophilin 1
    • Endophilin A1
    • Endophilin A1 BAR domain
    • Endophilin-1
    • Endophilin-A1
    • FLJ20276
    • FLJ25015
    • OTTHUMP00000021084
    • SH3 domain containing GRB2 like protein 2
    • SH3 domain GRB2 like 2
    • SH3 domain protein 2A
    • SH3 domain-containing GRB2-like protein 2
    • SH3D2A
    • SH3G2_HUMAN
    • Sh3gl2
    • Sh3p4
    • SH3PA
    see all
  • FunctionImplicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature.
  • Tissue specificityBrain, mostly in frontal cortex. Expressed at high level in fetal cerebellum.
  • Sequence similaritiesBelongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • DomainAn N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes. The BAR domain dimer forms a rigid crescent shaped bundle of helices with the pair of second amphipathic helices protruding towards the membrane-binding surface.
  • Cellular localizationCytoplasm. Membrane. Concentrated in presynaptic nerve terminals in neurons.
  • Information by UniProt

Recombinant Human SH3GL2 protein images

  • 12.5% SDS-PAGE of ab116741 at approximately 64.79kDa stained with Coomassie Blue.

References for Recombinant Human SH3GL2 protein (ab116741)

ab116741 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"