Recombinant Human SH3GL2 protein (ab116741)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEI MTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKF GRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKD LREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESS MFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQ PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL PH
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 352

Specifications

Our Abpromise guarantee covers the use of ab116741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • bA335L15.1 (SH3 domain GRB2 like 2)
    • CNSA2
    • EEN B1
    • EEN-B1
    • Endophilin 1
    • Endophilin A1
    • Endophilin A1 BAR domain
    • Endophilin-1
    • Endophilin-A1
    • FLJ20276
    • FLJ25015
    • OTTHUMP00000021084
    • SH3 domain containing GRB2 like protein 2
    • SH3 domain GRB2 like 2
    • SH3 domain protein 2A
    • SH3 domain-containing GRB2-like protein 2
    • SH3D2A
    • SH3G2_HUMAN
    • Sh3gl2
    • Sh3p4
    • SH3PA
    see all
  • Function
    Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature.
  • Tissue specificity
    Brain, mostly in frontal cortex. Expressed at high level in fetal cerebellum.
  • Sequence similarities
    Belongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Domain
    An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes. The BAR domain dimer forms a rigid crescent shaped bundle of helices with the pair of second amphipathic helices protruding towards the membrane-binding surface.
  • Cellular localization
    Cytoplasm. Membrane. Concentrated in presynaptic nerve terminals in neurons.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab116741 at approximately 64.79kDa stained with Coomassie Blue.

References

ab116741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up