Recombinant Human SHARP1 protein (ab164019)

Overview

  • Product name
    Recombinant Human SHARP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDR EKGKGAGASRVTIKQEPPGEDSPAPKRMKL
    • Amino acids
      203 to 282
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic helix-loop-helix domain containing class B3
    • BHE41_HUMAN
    • bHLH protein DEC2
    • bHLHB3
    • bHLHe41
    • Class B basic helix loop helix protein 3
    • Class B basic helix-loop-helix protein 3
    • Class E basic helix-loop-helix protein 41
    • DEC2
    • Differentially expressed in chondrocytes protein 2
    • Enhancer of split and hairy related protein 1
    • Enhancer-of-split and hairy-related protein 1
    • hDEC2
    • Moderately similar to basic-helix loop helix protein M.musculus
    • SHARP-1
    see all
  • Function
    May be a transcriptional repressor that represses both basal and activated transcription.
  • Tissue specificity
    Highly expressed in skeletal muscle and brain, moderately expressed in pancreas and heart, weakly expressed in placenta, lung, liver and kidney.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 Orange domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164019 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up