Recombinant Human SHARPIN protein (ab153538)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLS LHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPP
    • Amino acids
      51 to 148
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434N1923
    • hSIPL1
    • Shank associated RH domain interacting protein
    • SHANK associated RH domain interactor
    • Shank interacting protein like 1
    • Shank-associated RH domain-interacting protein
    • Shank-interacting protein-like 1
    • Sharpin
    • SHRPN_HUMAN
    • SIPL1
    see all
  • Function
    May have a role in normal immune development and control of inflammation.
  • Tissue specificity
    Highly expressed in skeletal muscle and placenta and at lower levels in brain, heart, colon without mucosa, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities
    Contains 1 RanBP2-type zinc finger.
  • Cellular localization
    Cytoplasm. Enriched at synaptic sites in mature neurons where it colocalizes with SHANK1.
  • Information by UniProt

Images

  • ab153538 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up