Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQI PPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISP
    • Amino acids
      381 to 480
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • N SHC
    • N-Shc
    • Neuronal Shc
    • NSHC
    • Protein Rai
    • Rai
    • SH2 domain protein C3
    • SHC (Src homology 2 domain containing) transforming protein 3
    • SHC adaptor protein 3
    • SHC protein C
    • SHC-like protein, neuronal
    • SHC-transforming protein 3
    • SHC-transforming protein C
    • Shc3
    • Shc3 p51
    • SHC3_HUMAN
    • SHCC
    • Src homology 2 domain-containing transforming protein
    • Src homology 2 domain-containing-transforming protein C3
    see all
  • Function
    Signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.
  • Tissue specificity
    Mainly expressed in brain. Hardly detectable in other tissues, except in pancreas. Highly expressed in the cerebral cortex, frontal and temporal lobes, occipital pole, hippocampus, caudate nucleus and amygdala. Expressed at low level in the cerebellum, medulla and spinal cord.
  • Sequence similarities
    Contains 1 PID domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Tyrosine phosphorylated.
  • Information by UniProt

Images

  • ab162690 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up