Overview

  • Product name
    Recombinant Human SHC4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSV GDKGSPQPPHPALAPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPAT LLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPPQQDL VGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCV EVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRKPPVEFLSTVL GKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPS LNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQ MAYCPIQCEKLCYLPGNSKCSSVYENCLEQSRAIGNVHPRGVQSQRGTSL LKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSPWHCGKAPETV QPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRE SATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN SLPIISSGSEVSLKQPVRKDNNPALLHSNK
    • Amino acids
      1 to 630
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hShcD
    • MGC34023
    • Rai like protein
    • Rai-like protein
    • RaLP
    • SH2 domain protein C4
    • SHC
    • SHC (Src homology 2 domain containing) family member 4
    • SHC 4
    • SHC adaptor protein 4
    • SHC family member 4
    • SHC transforming protein 4
    • SHC transforming protein D
    • SHC-transforming protein 4
    • SHC-transforming protein D
    • Shc4
    • SHC4_HUMAN
    • SHCD
    • Src homology 2 domain containing family member 4
    • Src homology 2 domain containing transforming protein C4
    • Src homology 2 domain-containing-transforming protein C4
    see all
  • Function
    Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.
  • Tissue specificity
    Only expressed in melanomas. Weakly expressed in normal melanocytes and benign nevi. Highly expressed at the transition from radial growth phase to vertical growth phase and metastatic melanomas, when tumor cells acquire migratory competence and invasive potential.
  • Sequence similarities
    Contains 1 PID domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Phosphorylated; the phosphorylation is enhanced by EGF. Phosphorylation at Tyr-424 is required for the interaction with GRB2.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Colocalized with MUSK at the neuromuscular junction.
  • Information by UniProt

Images

  • ab166484 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up