Overview

  • Product name
    Recombinant Human SHMT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTMPVNGAHKDADLWSSHDKMLAQPLKDSD VEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQ RYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTA LVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMA HISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKT GKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQ VVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEAC SIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIE LTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASFFPLPGL PDF
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 483
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab115713 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • CSHMT
    • Cytoplasmic serine hydroxymethyltransferase
    • cytosolic
    • GLYC_HUMAN
    • Glycine hydroxymethyltransferase
    • Serine hydroxymethyltransferase
    • Serine hydroxymethyltransferase 1 (soluble)
    • Serine hydroxymethyltransferase, cytosolic
    • Serine methylase
    • SHMT
    • Shmt1
    see all
  • Function
    Interconversion of serine and glycine.
  • Pathway
    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities
    Belongs to the SHMT family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115713 (3µg).

References

ab115713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up