Overview

  • Product name
    Recombinant Human SHMT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTMPVNGAHKDADLWSSHDKMLAQPLKDSD VEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQ RYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTA LVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMA HISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKT GKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQ VVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEAC SIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIE LTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASFFPLPGL PDF
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 483
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab115713 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • CSHMT
    • Cytoplasmic serine hydroxymethyltransferase
    • cytosolic
    • GLYC_HUMAN
    • Glycine hydroxymethyltransferase
    • Serine hydroxymethyltransferase
    • Serine hydroxymethyltransferase 1 (soluble)
    • Serine hydroxymethyltransferase, cytosolic
    • Serine methylase
    • SHMT
    • Shmt1
    see all
  • Function
    Interconversion of serine and glycine.
  • Pathway
    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities
    Belongs to the SHMT family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human SHMT1 protein images

  • 15% SDS-PAGE showing ab115713 (3µg).

References for Recombinant Human SHMT1 protein (ab115713)

ab115713 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up