Overview

  • Product nameRecombinant Human SHMT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP34896
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMTMPVNGAHKDADLWSSHDKMLAQPLKDSD VEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQ RYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTA LVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMA HISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKT GKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQ VVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEAC SIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIE LTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASFFPLPGL PDF
    • Molecular weight55 kDa including tags
    • Amino acids1 to 483
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab115713 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names
    • CSHMT
    • Cytoplasmic serine hydroxymethyltransferase
    • cytosolic
    • GLYC_HUMAN
    • Glycine hydroxymethyltransferase
    • Serine hydroxymethyltransferase
    • Serine hydroxymethyltransferase 1 (soluble)
    • Serine hydroxymethyltransferase, cytosolic
    • Serine methylase
    • SHMT
    • Shmt1
    see all
  • FunctionInterconversion of serine and glycine.
  • PathwayOne-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similaritiesBelongs to the SHMT family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SHMT1 protein images

  • 15% SDS-PAGE showing ab115713 (3µg).

References for Recombinant Human SHMT1 protein (ab115713)

ab115713 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"