Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPD AFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
    • Molecular weight
      35 kDa including tags
    • Amino acids
      117 to 204
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeobox protein Og12X
    • OG 12
    • OG 12X
    • OG12
    • OG12X
    • OGI 2X
    • OGI2X
    • Paired related homeobox protein SHOT
    • Paired-related homeobox protein SHOT
    • Short stature homeobox 2
    • Short stature homeobox homolog
    • Short stature homeobox protein 2
    • SHOT
    • SHOX 2
    • SHOX homologous gene on chromosome 3
    • SHOX2
    • SHOX2_HUMAN
    see all
  • Function
    May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.
  • Tissue specificity
    Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed during cranofacial development as well as in heart.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab112350 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up