Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPD AFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
    • Molecular weight
      35 kDa including tags
    • Amino acids
      117 to 204
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeobox protein Og12X
    • OG 12
    • OG 12X
    • OG12
    • OG12X
    • OGI 2X
    • OGI2X
    • Paired related homeobox protein SHOT
    • Paired-related homeobox protein SHOT
    • Short stature homeobox 2
    • Short stature homeobox homolog
    • Short stature homeobox protein 2
    • SHOT
    • SHOX 2
    • SHOX homologous gene on chromosome 3
    • SHOX2
    • SHOX2_HUMAN
    see all
  • Function
    May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.
  • Tissue specificity
    Expressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed during cranofacial development as well as in heart.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human SHOX2 protein images

  • ab112350 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human SHOX2 protein (ab112350)

ab112350 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up