Overview

  • Product name
    Recombinant Human SHPRH protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AQISRVKTFQENLSAFKRDPQINILLLPLHTGSNGLTIIEATHVLLVEPI LNPAHELQAIGRVHRIGQTKPTIVHRFLIKATIEERMQAMLKTAERSIYI
    • Amino acids
      1560 to 1659
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA545I5.2
    • E3 ubiquitin-protein ligase SHPRH
    • FLJ27258
    • FLJ37625
    • FLJ45012
    • FLJ90837
    • histone-linker
    • KIAA2023
    • MGC134886
    • PHD and RING finger domain-containing helicase
    • Shprh
    • SHPRH_HUMAN
    • SNF2
    • SNF2 histone linker PHD RING helicase
    see all
  • Function
    E3 ubiquitin-protein ligase involved in DNA repair. Upon genotoxic stress, accepts ubiquitin from the UBE2N-UBE2V2 E2 complex and transfers it to 'Lys-164' of PCNA which had been monoubiquitinated by UBE2A/B-RAD18, promoting the formation of non-canonical poly-ubiquitin chains linked through 'Lys-63'.
  • Tissue specificity
    Broadly expressed.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 H15 (linker histone H1/H5 globular) domain.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING finger mediates E3 ubiquitin ligase activity.
  • Information by UniProt

Images

  • ab166079 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up