Recombinant Human Shwachman Bodian-Diamond syndrome protein (ab99957)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIA CYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQ TEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTV ILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPV NEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKG KGSLEVLNLKDVEEGDEKFE
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 250
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99957 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.1mM EDTA, pH 8.0

General Info

  • Alternative names
    • 4733401P19Rik
    • AI836084
    • CGI 97
    • CGI-97
    • FLJ10917
    • MGC105922
    • Protein 22A3
    • Ribosome maturation protein SBDS
    • sbds
    • SBDS_HUMAN
    • SDS
    • Shwachman Bodian Diamond syndrome protein
    • Shwachman Bodian Diamond syndrome protein homolog
    • Shwachman-Bodian-Diamond syndrome protein
    • SWDS
    see all
  • Function
    Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in SBDS are the cause of Shwachman-Diamond syndrome (SDS) [MIM:260400]. SDS is an autosomal recessive disorder characterized by pancreatic exocrine insufficiency, hematologic dysfunction, and skeletal abnormalities.
  • Sequence similarities
    Belongs to the SDO1/SBDS family.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus. Nucleus > nucleoplasm. Cytoplasm > cytoskeleton > spindle. Primarily detected in the cytoplasm, and at low levels in nucleus and nucleolus (PubMed:19602484 and PubMed:17475909). Detected in the nucleolus during G1 and G2 phase of the cell cycle, and diffusely distributed in the nucleus during S phase. Detected at the mitotic spindle. Colocalizes with the microtubule organizing center during interphase.
  • Information by UniProt

Recombinant Human Shwachman Bodian-Diamond syndrome protein images

  • 15% SDS-PAGE showing ab99957 (3µg).

References for Recombinant Human Shwachman Bodian-Diamond syndrome protein (ab99957)

ab99957 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up