Overview

  • Product nameRecombinant Human SI protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14410
    • SpeciesHuman
    • SequenceDGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGK GTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
    • Molecular weight37 kDa including tags
    • Amino acids1728 to 1826

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Isomaltase
    • MGC131621
    • MGC131622
    • Oligosaccharide alpha 1, 6 glucosidase
    • SI
    • sucrase isomaltase
    • sucrase isomaltase alpha glucosidase
    • Sucrase-isomaltase, intestinal
    • SUIS_HUMAN
    see all
  • FunctionPlays an important role in the final stage of carbohydrate digestion.
  • Tissue specificityExpressed in the poorly differentiated crypt cells of the small intestine as well as in the mature villous cells. Expressed at very low levels in the colon.
  • Involvement in diseaseDefects in SI are the cause of congenital sucrase-isomaltase deficiency (CSID) [MIM:222900]; also known as disaccharide intolerance I. CSID is an autosomal recessive intestinal disorder that is clinically characterized by fermentative diarrhea, abdominal pain, and cramps upon ingestion of sugar. The symptoms are the consequence of absent or drastically reduced enzymatic activities of sucrase and isomaltase. The prevalence of CSID is 0.02 % in individuals of European descent and appears to be much higher in Greenland, Alaskan, and Canadian native people. CSID arises due to post-translational perturbations in the intracellular transport, polarized sorting, aberrant processing, and defective function of SI.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 31 family.
    Contains 2 P-type (trefoil) domains.
  • Post-translational
    modifications
    The precursor is proteolytically cleaved when exposed to pancreatic proteases in the intestinal lumen.
    Sulfated.
  • Cellular localizationApical cell membrane. Brush border.
  • Information by UniProt

Recombinant Human SI protein images

  • 12.5% SDS-PAGE showing ab114715 at approximately 36.52 kDa stained with Coomassie Blue.

References for Recombinant Human SI protein (ab114715)

ab114715 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"