Recombinant Human SIAT4A protein (ab152679)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKLSAWFDERF NQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      29 to 128

Specifications

Our Abpromise guarantee covers the use of ab152679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-GalNAc-alpha-2
    • 3-sialyltransferase
    • 3-sialyltransferase 1
    • 3-ST 1
    • Alpha 2
    • Alpha 23 ST
    • Beta galactoside alpha 23 sialyltransferase
    • Beta-galactoside alpha-2
    • beta-galactoside alpha-2,3-sialyltransferase 1
    • CMP N acetylneuraminate beta galactosamide alpha 23 sialyltransferase
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2
    • DKFZp666E036
    • DKFZp779K2051
    • FLJ36548
    • Gal beta 13 GalNAc alpha 23 sialyltransferase
    • Gal NAc6S
    • Gal-beta-1
    • Gal-NAc6S
    • MGC9183
    • OTTHUMP00000226912
    • OTTHUMP00000226913
    • SIA4A_HUMAN
    • Sialyltransferase 4A
    • SIAT4-A
    • SIAT4A
    • SIATFL
    • ST3Gal I
    • ST3GAL1
    • ST3GalA
    • ST3GalA.1
    • ST3GalI
    • ST3GalIA
    • ST3O
    see all
  • Function
    It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found on sugar chains O-linked to Thr or Ser and also as a terminal sequence on certain gangliosides. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
  • Tissue specificity
    Expressed in several tissues. Highest expression in lung, liver, skeletal muscle, kidney, pancreas, spleen and placenta.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Post-translational
    modifications
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152679 stained with Coomassie Blue.

References

ab152679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up