Recombinant Human Signal Peptide Peptidase protein (ab153530)

Overview

  • Product name
    Recombinant Human Signal Peptide Peptidase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFG ALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEY INLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG
    • Amino acids
      1 to 143
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ324O17.1
    • H13
    • hIMP1
    • Histocompatibility (minor) 13
    • HM13
    • HM13_HUMAN
    • IMP-1
    • IMP1
    • IMPAS
    • IMPAS-1
    • Intramembrane protease
    • Intramembrane protease 1
    • Minor histocompatibility antigen 13
    • Minor histocompatibility antigen H13
    • MSTP086
    • OTTHUMP00000030527
    • OTTHUMP00000030528
    • OTTHUMP00000030530
    • OTTHUMP00000214528
    • Presenilin-like protein 3
    • PSENL3
    • PSL3
    • Signal peptide peptidase
    • Signal peptide peptidase beta
    • SPP
    see all
  • Function
    Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection (By similarity). May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1.
  • Tissue specificity
    Widely expressed with highest levels in kidney, liver, placenta, lung, leukocytes and small intestine and reduced expression in heart and skeletal muscle. Expressed abundantly in the CNS with highest levels in thalamus and medulla.
  • Sequence similarities
    Belongs to the peptidase A22B family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane and Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab153530 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up