Recombinant Human SIPA1L2 protein (ab163591)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEASRHPETKWHGPPSKVLGSYKERALQKDGSCKDSPNKLSHIGDKSCSS HSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKGASTDSGIDTAPC MPATILGPVHLAGSRSLIHSRAEQWADAADVSGPDDEPAKLYSVHGYASA ISAGSAAEGSMGDLSEISSHSSGSHHSGSPSAHCSKSSGSLDSSKVYIVS HSSGQQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYS EMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPDSPLVEEGRRKFS FYGNLSPRRSLYRTLSDESICSNRRGSSFGSSRSSVLDQALPNDILFSTT PPYHSTLPPRAHPAPSMGSLRNEFWFSDGSLSDKSKCADPGLMPLPDTAT GLDWTHLVDAARAFEDQRVASFCTLTDMQHGQDLEGAQELPLCVDPGSGK EFMDTTGERSPSPLTGKVNQLELILRQLQTDLRKEKQDKAVLQAEVQHLR QDNMRLQEESQTATAQLRKFTEWFFTTIDKKS
    • Amino acids
      1 to 532
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1389
    • SI1L2_HUMAN
    • Signal induced proliferation associated 1 like protein 2
    • Signal-induced proliferation-associated 1-like protein 2
    • SIPA1 like protein 2
    • SIPA1-like protein 2
    • SIPA1L2
    • SPAL2
    see all
  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
    Contains 1 Rap-GAP domain.
  • Information by UniProt

Images

  • ab163591 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up