Recombinant Human SIRP alpha protein (ab151920)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIY NQKEGHFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPD TEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT LKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQ RLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTC QVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNERNVDHHHHHH
    • Molecular weight
      38 kDa including tags
    • Amino acids
      31 to 370
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • Signal regulatory protein alpha type 1
    • Bit
    • Brain Ig like molecule with tyrosine based activation motifs
    • Brain Ig-like molecule with tyrosine-based activation motifs
    • Brain immunoglobulin like molecule with tyrosine based activation motifs
    • CD172 antigen like family member A
    • CD172 antigen-like family member A
    • CD172a
    • CD172a antigen
    • Inhibitory receptor SHPS-1
    • Macrophage fusion receptor
    • MFR
    • MYD 1
    • Myd 1 antigen
    • MyD-1 antigen
    • p84
    • Protein tyrosine phosphatase non receptor type substrate 1
    • PTPNS1
    • SHP substrate 1
    • SHPS-1
    • SHPS1
    • SHPS1_HUMAN
    • Signal regulatory protein alpha
    • Signal regulatory protein alpha 2
    • Signal regulatory protein alpha 3
    • Signal regulatory protein alpha type 2
    • Signal-regulatory protein alpha-1
    • Signal-regulatory protein alpha-2
    • Signal-regulatory protein alpha-3
    • SIRP
    • Sirp-alpha-1
    • Sirp-alpha-2
    • Sirp-alpha-3
    • SIRPA
    • SIRPalpha
    • SIRPalpha1
    • SIRPalpha2
    • SIRPalpha3
    • Tyrosine phosphatase SHP substrate 1
    • Tyrosine protein phosphatase non receptor type substrate 1
    • Tyrosine-protein phosphatase non-receptor type substrate 1
    see all
  • Function
    Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.
  • Tissue specificity
    Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.
  • Sequence similarities
    Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    N-glycosylated.
    Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab151920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up