Recombinant Human SIRP beta 1/CD172b protein (ab160947)

Overview

  • Product name
    Recombinant Human SIRP beta 1/CD172b protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESA TLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNN LDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAP TAPLLVALLLGPKLLLVVGVSAIYICWKQKA
    • Amino acids
      1 to 181
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD172 antigen like family member B
    • CD172b
    • CD172b antigen
    • DKFZp686A05192
    • Signal regulatory protein beta 1
    • SIRP BETA 1
    • SIRP beta 1 isoform 3
    see all
  • Relevance
    The protein encoded by the SIRPß1 gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins which are known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. SIRPß1 was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization
    Cell Membrane; single-pass type I membrane protein

Images

  • ab160947 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up