Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDFLRNLFSQTLSLGSQKERLLDELTLEGV ARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEA IFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQ NIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEV TPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQ PFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRD VAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSA SPKKSPPPAKDEARTTEREKPQ
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 352
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab102024 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.5mM EDTA, pH 8.0

General Info

  • Alternative names
    • FLJ35621
    • FLJ37491
    • NAD dependent deacetylase sirtuin 2
    • NAD-dependent deacetylase sirtuin-2
    • NAD-dependent protein deacetylase sirtuin-2
    • Regulatory protein SIR2 homolog 2
    • Silencing information regulator 2 like
    • Silent information regulator 2
    • SIR2
    • SIR2 like protein 2
    • Sir2 related protein type 2
    • SIR2, S. cerevisiae, homolog-loke 2
    • SIR2-like protein 2
    • SIR2L
    • SIR2L2
    • SIRT2
    • SIRT2_HUMAN
    • Sirtuin (silent mating type information regulation 2 homolog) 2 (S.cerevisiae)
    • Sirtuin 2
    • Sirtuin type 2
    see all
  • Function
    NAD-dependent protein deacetylase, which deacetylates the 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton.
  • Tissue specificity
    Widely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network.
  • Sequence similarities
    Belongs to the sirtuin family.
    Contains 1 deacetylase sirtuin-type domain.
  • Developmental stage
    Peaks during mitosis. After mitosis, it is probably degraded by the 26S proteasome.
  • Post-translational
    modifications
    Phosphorylated at the G2/M transition of the cell cycle.
  • Cellular localization
    Cytoplasm > cytoskeleton. Colocalizes with microtubules.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102024 (3µg)

References

ab102024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up