Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8IXJ6-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDFLRNLFSQTLSLGSQKERLLDELTLEGV ARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEA IFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQ NIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEV TPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQ PFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRD VAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSA SPKKSPPPAKDEARTTEREKPQ
    • Molecular weight42 kDa including tags
    • Amino acids1 to 352
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab102024 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.5mM EDTA, pH 8.0

General Info

  • Alternative names
    • FLJ35621
    • FLJ37491
    • NAD dependent deacetylase sirtuin 2
    • NAD-dependent deacetylase sirtuin-2
    • NAD-dependent protein deacetylase sirtuin-2
    • Regulatory protein SIR2 homolog 2
    • Silencing information regulator 2 like
    • Silent information regulator 2
    • SIR2
    • SIR2 like protein 2
    • Sir2 related protein type 2
    • SIR2, S. cerevisiae, homolog-loke 2
    • SIR2-like protein 2
    • SIR2L
    • SIR2L2
    • SIRT2
    • SIRT2_HUMAN
    • Sirtuin (silent mating type information regulation 2 homolog) 2 (S.cerevisiae)
    • Sirtuin 2
    • Sirtuin type 2
    see all
  • FunctionNAD-dependent protein deacetylase, which deacetylates the 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton.
  • Tissue specificityWidely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network.
  • Sequence similaritiesBelongs to the sirtuin family.
    Contains 1 deacetylase sirtuin-type domain.
  • Developmental stagePeaks during mitosis. After mitosis, it is probably degraded by the 26S proteasome.
  • Post-translational
    modifications
    Phosphorylated at the G2/M transition of the cell cycle.
  • Cellular localizationCytoplasm > cytoskeleton. Colocalizes with microtubules.
  • Information by UniProt

Recombinant Human SIRT2 protein images

  • 15% SDS-PAGE analysis of ab102024 (3µg)

References for Recombinant Human SIRT2 protein (ab102024)

ab102024 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"