Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFDFLRNLFSQTLSLGSQKERLL DELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEK YHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWM KEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLV MGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDF DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAG VPNPSTSASPKKSPPPAKDEARTTEREKPQ
    • Molecular weight
      43 kDa including tags
    • Amino acids
      2 to 352
    • Tags
      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169902 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol

General Info

  • Alternative names
    • FLJ35621
    • FLJ37491
    • NAD dependent deacetylase sirtuin 2
    • NAD-dependent deacetylase sirtuin-2
    • NAD-dependent protein deacetylase sirtuin-2
    • Regulatory protein SIR2 homolog 2
    • Silencing information regulator 2 like
    • Silent information regulator 2
    • SIR2
    • SIR2 like protein 2
    • Sir2 related protein type 2
    • SIR2, S. cerevisiae, homolog-loke 2
    • SIR2-like protein 2
    • SIR2L
    • SIR2L2
    • SIRT2
    • SIRT2_HUMAN
    • Sirtuin (silent mating type information regulation 2 homolog) 2 (S.cerevisiae)
    • Sirtuin 2
    • Sirtuin type 2
    see all
  • Function
    NAD-dependent protein deacetylase, which deacetylates the 'Lys-40' of alpha-tubulin. Involved in the control of mitotic exit in the cell cycle, probably via its role in the regulation of cytoskeleton.
  • Tissue specificity
    Widely expressed. Highly expressed in heart, brain and skeletal muscle, while it is weakly expressed in placenta and lung. Down-regulated in many gliomas suggesting that it may act as a tumor suppressor gene in human gliomas possibly through the regulation of microtubule network.
  • Sequence similarities
    Belongs to the sirtuin family.
    Contains 1 deacetylase sirtuin-type domain.
  • Developmental stage
    Peaks during mitosis. After mitosis, it is probably degraded by the 26S proteasome.
  • Post-translational
    modifications
    Phosphorylated at the G2/M transition of the cell cycle.
  • Cellular localization
    Cytoplasm > cytoskeleton. Colocalizes with microtubules.
  • Information by UniProt

References

ab169902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up