Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGA GISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERV SGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGV VKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRS SVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDL VQRETGKLDGPDK
    • Molecular weight
      34 kDa including tags
    • Amino acids
      118 to 399
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab97951 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • hSIRT 3
    • hSIRT3
    • Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase
    • NAD dependent deacetylase sirtuin 3 mitochondrial
    • NAD-dependent protein deacetylase sirtuin-3, mitochondrial
    • Regulatory protein SIR2 homolog 3
    • Silent mating type information regulation 2 S.cerevisiae homolog 3
    • Sir 2 like 3
    • SIR 2 like protein 3
    • SIR 3
    • SIR2 L3
    • Sir2 like 3
    • SIR2 like protein 3
    • SIR2-like protein 3
    • SIR2L3
    • SIR3_HUMAN
    • SIRT 3
    • SIRT3
    • Sirtuin 3
    • Sirtuin silent mating type information regulation 2 homolog 3 (S. cerevisiae)
    • Sirtuin type 3
    • Sirtuin3
    see all
  • Function
    NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the sirtuin family. Class I subfamily.
    Contains 1 deacetylase sirtuin-type domain.
  • Post-translational
    modifications
    Processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Such processing is probably essential for its enzymatic activity.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab97951 at approximately 33.5kDa (3µg).

References

ab97951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up