Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRF ITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAP IRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHT KAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLA PDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRV KEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKL NSRCGELLPLIDPC
    • Molecular weight
      62 kDa including tags
    • Amino acids
      1 to 314
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab176942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • MGC130046
    • MGC130047
    • MGC57437
    • NAD dependent deacetylase sirtuin 4
    • NAD dependent protein deacetylase sirtuin 4
    • NAD-dependent ADP-ribosyltransferase sirtuin-4
    • NAD-dependent protein deacetylase sirtuin-4
    • NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
    • Regulatory protein SIR2 homolog 4
    • Silent mating type information regulation 2 homolog
    • Sir 2 like 4
    • SIR 2 like protein 4
    • Sir2 like 4
    • SIR2 like protein 4
    • SIR2-like protein 4
    • SIR2L 4
    • SIR2L4
    • SIR4_HUMAN
    • SIRT 4
    • Sirt4
    • Sirtuin (silent mating type information regulation 2 homolog) 4
    • Sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
    • Sirtuin 4
    • Sirtuin type 4
    • Sirtuin-4
    • Sirtuin4
    see all
  • Function
    Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. Catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications. Inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner (PubMed:25525879). Catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1, inhibiting GLUD1 enzyme activity. Acts as a negative regulator of mitochondrial glutamine metabolism by mediating mono ADP-ribosylation of GLUD1: expressed in response to DNA damage and negatively regulates anaplerosis by inhibiting GLUD1, leading to block metabolism of glutamine into tricarboxylic acid cycle and promoting cell cycle arrest (PubMed:16959573, PubMed:17715127). In response to mTORC1 signal, SIRT4 expression is repressed, promoting anaplerosis and cell proliferation. Acts as a tumor suppressor (PubMed:23562301, PubMed:23663782). Also acts as a NAD-dependent protein deacetylase: mediates deacetylation of 'Lys-471' of MLYCD, inhibiting its activity, thereby acting as a regulator of lipid homeostasis (By similarity). Controls fatty acid oxidation by inhibiting PPARA transcriptional activation. Impairs SIRT1:PPARA interaction probably through the regulation of NAD(+) levels (PubMed:24043310). Down-regulates insulin secretion.
  • Tissue specificity
    Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus.
  • Sequence similarities
    Belongs to the sirtuin family. Class II subfamily.
    Contains 1 deacetylase sirtuin-type domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176942.

    Lane 1; 4 µg

    Lane 2; 2 µg

    Lane 3; 1 µg

References

ab176942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up