Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLY GNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIP GPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYAN SQPAAS
    • Molecular weight
      17 kDa including tags
    • Amino acids
      62 to 196
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113580 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol

General Info

  • Alternative names
    • gp30/40
    • SHP intracting transmembrane adapter protein
    • SHP2-interacting transmembrane adapter protein
    • Signaling threshold-regulating transmembrane adapter 1
    • SIT
    • Sit1
    • SIT1_HUMAN
    • Suppression inducing transmembrane adapter 1
    • Suppression-inducing transmembrane adapter 1
    see all
  • Function
    Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells. Involved in positive selection of T-cells.
  • Tissue specificity
    Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma.
  • Post-translational
    modifications
    Phosphorylated on tyrosines by LCK, FYN or ZAP70 upon TCR activation; which leads to the recruitment of PTPN11, GRB2 and CSK.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human SIT protein images

  • 15% SDS-PAGE showing ab113580 (3µg).

    Note: Molecular weight on SDS-PAGE will appear higher.

References for Recombinant Human SIT protein (ab113580)

ab113580 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up