Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLY GNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIP GPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYAN SQPAAS
    • Molecular weight
      17 kDa including tags
    • Amino acids
      62 to 196
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113580 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol

General Info

  • Alternative names
    • gp30/40
    • SHP intracting transmembrane adapter protein
    • SHP2-interacting transmembrane adapter protein
    • Signaling threshold-regulating transmembrane adapter 1
    • SIT
    • Sit1
    • SIT1_HUMAN
    • Suppression inducing transmembrane adapter 1
    • Suppression-inducing transmembrane adapter 1
    see all
  • Function
    Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells. Involved in positive selection of T-cells.
  • Tissue specificity
    Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma.
  • Post-translational
    modifications
    Phosphorylated on tyrosines by LCK, FYN or ZAP70 upon TCR activation; which leads to the recruitment of PTPN11, GRB2 and CSK.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113580 (3µg).

    Note: Molecular weight on SDS-PAGE will appear higher.

References

ab113580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up