Overview

  • Product name
    Recombinant Human SIX2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVL KAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRG RPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPS PREKRELTEATGLTTTQVSNWFKNRRQRDRAAEAKERENNENSNSNSHNP LNGSGKSVLGSSEDEKTPSGTPDHSSSSPALLLSPPPPGLPSLHSLGHPP GPSAVPVPVPGGGGADPLQHHHGLQDSILNPMSANLVDLGS
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 291

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeobox protein SIX2
    • OTTHUMP00000201649
    • Sine oculis homeobox (Drosophila) homolog 2
    • Sine oculis homeobox homolog 2
    • Sine oculis homeobox homolog 2 (Drosophila)
    • SIX homeobox 2
    • Six2
    • SIX2_HUMAN
    see all
  • Function
    May be involved in limb tendon and ligament development.
  • Tissue specificity
    Strongly expressed in skeletal muscle.
  • Sequence similarities
    Belongs to the SIX/Sine oculis homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132611 stained with Coomassie Blue.

References

ab132611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up