Recombinant Human Skeletrophin / Mib2 protein (ab165489)

Overview

  • Product name
    Recombinant Human Skeletrophin / Mib2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWT FSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL
    • Amino acids
      381 to 480
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase MIB2
    • Mib2
    • Mindbomb homolog 2
    • Novel zinc finger protein
    • Novelzin
    • Putative NF-kappa-B-activating protein 002N
    • SKD
    • Skeletrophin
    • Zinc finger ZZ type with ankyrin repeat domain protein 1
    • ZZANK1
    see all
  • Relevance
    Skeletrophin, also known as Mib2, is a homolog of the zebrafish protein Mindbomb. Skeletrophin is an E3 ubiquitin ligase, expressed mainly in skeletal muscle, which is downregulated in malignant melanoma.
  • Cellular localization
    Cytoplasmic

Images

  • ab165489 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up