Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13309
    • SpeciesHuman
    • SequenceMHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSEN IPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSL PDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPD VTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHG ILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQT LLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIP ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPT IGNKKNQEIWGIKCRLTLQKPSCL
    • Molecular weight73 kDa including tags
    • Amino acids1 to 424

Specifications

Our Abpromise guarantee covers the use of ab114385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114385 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CDK2/Cyclin A associated protein p45
    • Cyclin A/CDK2 associated protein p45
    • Cyclin-A/CDK2-associated protein p45
    • F box protein Skp2
    • F box/LRR repeat protein 1
    • F-box protein Skp2
    • F-box/LRR-repeat protein 1
    • FBL 1
    • FBL1
    • FBXL 1
    • FBXL1
    • FLB 1
    • FLB1
    • MGC1366
    • p45
    • p45skp2
    • S phase kinase associated protein 2
    • S phase kinase associated protein 2 (p45)
    • S-phase kinase-associated protein 2
    • S-phase kinase-associated protein 2 E3 ubiquitin protein ligase
    • SKP 2
    • Skp2
    • SKP2_HUMAN
    see all
  • FunctionSubstrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, MLL, CDK9, RAG2, FOXO1A, UBP43, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 F-box domain.
    Contains 9 LRR (leucine-rich) repeats.
  • Information by UniProt

Recombinant Human SKP2 protein images

  • ab114385 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human SKP2 protein (ab114385)

ab114385 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"