Recombinant Human SLAIN2 protein (ab163604)

Overview

  • Product name
    Recombinant Human SLAIN2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHH AVYPAVNRFSPSPRNSPRPSPKQSPRNSPRSRSPARGIEYSRVSPQPMIS RLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRS DSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGS GSPGSQEITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMR SGLPRPSAPSAGGIPVPRSKLAQPVRRSLPAPKTYGSMKDDSWKDGCY
    • Amino acids
      1 to 298
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ21611
    • KIAA1458
    • SLAI2_HUMAN
    • SLAIN motif containing 2
    • SLAIN motif family member 2
    • SLAIN motif-containing protein 2
    • SLAIN2
    see all
  • Function
    Binds to the plus end of microtubules and regulates microtubule dynamics and microtubule organization. Promotes cytoplasmic microtubule nucleation and elongation. Required for normal structure of the microtubule cytoskeleton during interphase.
  • Tissue specificity
    Widely expressed with highest levels in adult liver, testis and ovary, and lowest levels in adult pancreas and spleen and in fetal brain.
  • Sequence similarities
    Belongs to the SLAIN motif-containing family.
  • Domain
    The N-terminus forms a two-stranded coiled coil.
  • Post-translational
    modifications
    Is highly phosphorylated during mitosis, but not during interphase. The highly phosphorylated form does not localize at microtubule plus ends and does not interact with MAPRE1 or CKAP5.
  • Cellular localization
    Cytoplasm > cytoskeleton. Colocalizes with microtubules. Detected at the plus end of growing microtubules.
  • Information by UniProt

Images

  • ab163604 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up