Recombinant Human SLAMF6 protein (ab151940)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETK SPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSS YTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGN TLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQY TDTKVDHHHHHH
    • Molecular weight
      24 kDa including tags
    • Amino acids
      22 to 226
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151940 has a purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • Activating NK receptor
    • CD352
    • KALI
    • KALIb
    • LY108
    • MGC104953
    • Natural killer T and B cell antigen
    • NK T B antigen
    • NK-, T-, and B-cell antigen
    • NK-T-B-antigen
    • NTB A
    • NTB-A
    • NTBA
    • NTBA receptor
    • SF2000
    • SLAF6_HUMAN
    • SLAM family member 6
    • SLAM family member 6 precursor
    • SLAM Family Receptor
    • Slamf6
    see all
  • Function
    Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors.
  • Tissue specificity
    Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab151940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up