Recombinant Human SLAP2 protein (denatured) (ab174415)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMGSLPSRRKSLPSPSLSSSVQGQGPVT MEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSG REYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRR GSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYS ELADDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFS EAATGEESLLSEGLRESLSFYISLNDEAVSLDDA
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 261
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No. NP_115590).

Specifications

Our Abpromise guarantee covers the use of ab174415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • A930009E21Rik
    • AI430952
    • C20orf156
    • FLJ21992
    • MARS
    • MGC49845
    • Modulator of antigen receptor signaling
    • RGD1562071
    • SLA 2
    • SLA2
    • SLAP 2
    • SLAP-2
    • SLAP2
    • SLAP2_HUMAN
    • Src like adapter protein 2
    • Src like adaptor 2
    • Src-like adapter protein 2
    • Src-like-adapter 2
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174415 (3 µg).

References

ab174415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up