Recombinant Human SLC12A1 protein (ab114560)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRP SLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
    • Molecular weight
      36 kDa including tags
    • Amino acids
      80 to 172

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BSC1
    • Bumetanide sensitive sodium 3
    • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
    • Kidney specific Na K Cl symporter
    • Kidney-specific Na-K-Cl symporter
    • MGC48843
    • Na K 2Cl cotransporter
    • NKCC2
    • potassiumchloride cotransporter 2
    • S12A1_HUMAN
    • Slc12a1
    • sodium potassium chloride cotransporter 2
    • solute carrier family 12 (sodium/potassium/chloride transporters)
    • Solute carrier family 12 member 1
    see all
  • Function
    Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
  • Tissue specificity
    Kidney specific.
  • Involvement in disease
    Defects in SLC12A1 are the cause of Bartter syndrome type 1 (BS1) [MIM:601678]. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS1 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS1 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
  • Sequence similarities
    Belongs to the SLC12A transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up