Recombinant Human SLC13A3 protein (ab163892)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAV YWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMA SAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSMWLSNTASTAM MLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLAS TEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATL TGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFC MFAILLFTRDPKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLK WWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSV WIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAI RLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLL MNLMGVLLLSLAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFR TL
    • Amino acids
      1 to 602
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • +dicarboxylate cotransporter 3
    • H sapiens mRNA for hepatocyte nuclear factor 4 gamma
    • hNaDC3
    • Na
    • Na(+)/dicarboxylate cotransporter 3
    • NaDC 3
    • NaDC-3
    • NADC3
    • S13A3_HUMAN
    • SDCT 2
    • SDCT2
    • SLC13A3
    • Sodium dependent high affinity dicarboxylate transporter 2
    • Sodium dependent high affinity dicarboxylate transporter 3
    • Sodium-dependent high-affinity dicarboxylate transporter 2
    • Solute carrier family 13 (sodium dependent dicarboxylate transporter), member 3
    • Solute carrier family 13 member 3
    see all
  • Function
    High-affinity sodium-dicarboxylate cotransporter that accepts a range of substrates with 4-5 carbon atoms. The stoichiometry is probably 3 Na(+) for 1 divalent succinate.
  • Tissue specificity
    Expression is highest in kidney. Detected in placenta, brain, liver and pancreas.
  • Sequence similarities
    Belongs to the SLC13A transporter (TC 2.A.47) family. NADC subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab163892 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up