Recombinant Human SLC13A4 protein (ab161952)

Overview

  • Product name
    Recombinant Human SLC13A4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGV PSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMIC KCLSLSISY
    • Amino acids
      166 to 274
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Na(+)/sulfate cotransporter SUT-1
    • NaS2
    • S13A4_HUMAN
    • SLC13A4
    • Solute carrier family 13 member 4
    • SUT1
    see all
  • Function
    Sodium/sulfate cotransporter that mediates sulfate reabsorption in the high endothelial venules (HEV).
  • Tissue specificity
    Highly expressed in placenta and testis with intermediate levels in brain and lower levels in heart, thymus and liver.
  • Sequence similarities
    Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161952 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up