Recombinant Human SLC14A2 protein (ab159953)

Overview

  • Product name
    Recombinant Human SLC14A2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCI CLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ
    • Amino acids
      40 to 128
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ16167
    • hUT-A6
    • HUT2
    • kidney
    • MGC119566
    • MGC119567
    • Slc14a2
    • Solute carrier family 14 (urea transporter), member 2
    • Solute carrier family 14 member 2
    • Urea transporter
    • Urea transporter 2
    • Urea transporter, kidney
    • UT-A2
    • UT2
    • UT2_HUMAN
    • UTA
    • UTR
    see all
  • Function
    Specialized low-affinity vasopressin-regulated urea transporter. Mediates rapid transepithelial urea transport across the inner medullary collecting duct and plays a major role in the urinary concentrating mechanism.
  • Tissue specificity
    Isoform 1 and isoform 2 are expressed in the inner medulla of the kidney.
  • Sequence similarities
    Belongs to the urea transporter family.
  • Cellular localization
    Apical cell membrane.
  • Information by UniProt

Images

  • ab159953 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up