Recombinant Human SLC15A1 protein (ab114579)

Overview

  • Product name
    Recombinant Human SLC15A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFP SGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      473 to 572

Specifications

Our Abpromise guarantee covers the use of ab114579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • +peptide cotransporter
    • HPECT1
    • HPEPT1
    • Human peptide transporter (HPEPT1) mRNA complete cds
    • Intestinal H
    • Intestinal H(+)/peptide cotransporter
    • Oligopeptide transporter
    • Oligopeptide transporter small intestine isoform
    • PEPT1
    • Peptide transporter 1
    • S15A1_HUMAN
    • Slc15a1
    • small intestine isoform
    • Solute carrier family 15 (oligopeptide transporter) member 1
    • Solute carrier family 15 member 1
    see all
  • Function
    Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products.
  • Sequence similarities
    Belongs to the PTR2/POT transporter (TC 2.A.17) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114579 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up