Recombinant Human SLC15A1 protein (ab114579)

Overview

  • Product nameRecombinant Human SLC15A1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP46059
    • SpeciesHuman
    • SequenceVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFP SGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
    • Molecular weight37 kDa including tags
    • Amino acids473 to 572

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • +peptide cotransporter
    • HPECT1
    • HPEPT1
    • Human peptide transporter (HPEPT1) mRNA complete cds
    • Intestinal H
    • Intestinal H(+)/peptide cotransporter
    • Oligopeptide transporter
    • Oligopeptide transporter small intestine isoform
    • PEPT1
    • Peptide transporter 1
    • S15A1_HUMAN
    • Slc15a1
    • small intestine isoform
    • Solute carrier family 15 (oligopeptide transporter) member 1
    • Solute carrier family 15 member 1
    see all
  • FunctionProton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products.
  • Sequence similaritiesBelongs to the PTR2/POT transporter (TC 2.A.17) family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human SLC15A1 protein images

  • ab114579 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human SLC15A1 protein (ab114579)

ab114579 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"