Recombinant Human SLC15A1 protein (ab114579)

Overview

  • Product name
    Recombinant Human SLC15A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFP SGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      473 to 572

Specifications

Our Abpromise guarantee covers the use of ab114579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • +peptide cotransporter
    • HPECT1
    • HPEPT1
    • Human peptide transporter (HPEPT1) mRNA complete cds
    • Intestinal H
    • Intestinal H(+)/peptide cotransporter
    • Oligopeptide transporter
    • Oligopeptide transporter small intestine isoform
    • PEPT1
    • Peptide transporter 1
    • S15A1_HUMAN
    • Slc15a1
    • small intestine isoform
    • Solute carrier family 15 (oligopeptide transporter) member 1
    • Solute carrier family 15 member 1
    see all
  • Function
    Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products.
  • Sequence similarities
    Belongs to the PTR2/POT transporter (TC 2.A.17) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human SLC15A1 protein images

  • ab114579 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human SLC15A1 protein (ab114579)

ab114579 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up