Recombinant Human SLC17A4 protein (ab160785)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDW SPEIQGIILSSLNYGSFLAPIPSGYV
    • Amino acids
      56 to 131
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KAIA2138
    • KIAA2138
    • MGC129623
    • Na/PO4 cotransporter
    • Probable small intestine urate exporter
    • S17A4_HUMAN
    • Slc17a4
    • SLC17A4 protein
    • Solute carrier family 17 (sodium phosphate) member 4
    • Solute carrier family 17 member 4
    see all
  • Function
    Acts as a membrane potential-dependent organic anion transporter, the transport requires a low concentration of chloride ions. May be involved in urate extrusion from the intestinal duct. May recognize hydrophilic anionic drugs such as aspirin, salicylate, and ibuprofen as substrates. Able to actively transport inorganic phosphate into cells via Na(+) cotransport (in vitro).
  • Tissue specificity
    Abundantly expressed in pancreas, liver, colon and small intestine, less in kidney. Not detected in the adrenal glands, brain, placenta, heart, testis, skeletal muscle, and lungs.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Sodium/anion cotransporter family.
  • Cellular localization
    Apical cell membrane. Cell membrane. Apical in the intestinal brush border.
  • Information by UniProt

Images

  • ab160785 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up