Recombinant Human SLC19A3 protein (ab164275)

Overview

  • Product name
    Recombinant Human SLC19A3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILST SGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR
    • Amino acids
      191 to 277
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Solute carrier family 19 member 3
    • Thiamine transporter 2
    • thTr 2
    • THTR2
  • Relevance
    SLC19A3 is a member of the reduced folate family of micronutrient transporter genes. It is a ubiquitously expressed transmembrane thiamine transporter that lacks folate transport activity yet mediates high affinity thiamine uptake propably via a proton anti-port mechanism. Mutations in this gene cause biotin-responsive basal ganglia disease (BBGD); a recessive disorder manifested in childhood that progresses to chronic encephalopathy, dystonia, quadriparesis, and death if untreated. Patients with BBGD have bilateral necrosis in the head of the caudate nucleus and in the putamen. Mutations in this gene also cause a Wernicke's-like encephalopathy.
  • Cellular localization
    Plasma membrane

Images

  • ab164275 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up