Recombinant Human SLC1A4 protein (ab159516)

Overview

  • Product name
    Recombinant Human SLC1A4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFR TYATDYKVVTQNSSSGNVTHEKIPIGT
    • Amino acids
      140 to 216
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alanine/serine/cysteine/threonine transporter 1
    • ASCT-1
    • ASCT1
    • AW045657
    • Glutamate/neutral amino acid transporter
    • Neutral amino acid transporter A
    • OTTHUMP00000159933
    • OTTHUMP00000235138
    • SATT
    • SATT_HUMAN
    • SLC1A4
    • Solute carrier family 1 (glutamate/neutral amino acid transporter), member 4
    • Solute carrier family 1 member 4
    see all
  • Function
    Transporter for alanine, serine, cysteine, and threonine. Exhibits sodium dependence.
  • Tissue specificity
    Expressed mostly in brain, muscle, and pancreas but detected in all tissues examined.
  • Involvement in disease
    Spastic tetraplegia, thin corpus callosum, and progressive microcephaly
  • Sequence similarities
    Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A4 subfamily.
  • Cellular localization
    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab159516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up