Recombinant Human SLC22A18AS protein (ab159036)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNV PGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGRE HAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT
    • Amino acids
      1 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beckwith-Wiedemann region 1B
    • Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein
    • Beckwith-Wiedemann syndrome chromosome region 1, candidate b
    • BWR1B
    • BWR1B_HUMAN
    • BWSCR1B
    • ORCTL2S
    • Organic cation transporter like 2 antisense
    • Organic cation transporter-like protein 2 antisense protein
    • OTTHUMP00000229183
    • p27-Beckwith-Wiedemann region 1 B
    • p27-BWR1B
    • SLC22A18AS
    • SLC22A1LS
    • Solute carrier family 22 (organic cation transporter), member 1 like antisense
    • Solute carrier family 22 (organic cation transporter), member 18 antisense
    • Solute carrier family 22 member 1-like antisense protein
    • Solute carrier family 22 member 18 antisense protein
    see all
  • Tissue specificity
    Most abundantly expressed in gastrointestinal tissues. Expressed at lower levels in kidney and placenta. Expressed in fetal brain, liver, placenta, kidney and lung.
  • Information by UniProt

Images

  • ab159036 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up