Recombinant Human SLC22A3 protein (ab116794)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHST IVSEFDLVCVNAWMLD
    • Molecular weight
      33 kDa including tags
    • Amino acids
      90 to 155

Specifications

Our Abpromise guarantee covers the use of ab116794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EMT
    • EMT organic cation transporter 3
    • EMTH
    • Extraneuronal monoamine transporter
    • OCT 3
    • OCT3
    • Orct 3
    • Orct3
    • Organic cation transporter 3
    • S22A3_HUMAN
    • SLC22 A3
    • SLC22A 3
    • Slc22a3
    • Solute carrier family 22 (extraneuronal monoamine transporter) member 3
    • Solute carrier family 22 (organic cation transporter) member 3
    • Solute carrier family 22 member 3
    see all
  • Function
    Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
  • Tissue specificity
    Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116794 at approximately 32.89kDa.
    Stained with Coomassie Blue.

References

ab116794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up