Recombinant Human SLC22A8 protein (ab160461)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCR PPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWV YNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRR PILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVE WVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFF LSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEE FGVNLYILQIIFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILAL TFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSN LWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALFLPETLNQPL PETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
    • Amino acids
      1 to 542
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hOAT3
    • OAT3
    • Organic anion transporter 3
    • S22A8_HUMAN
    • SLC22A8
    • Solute carrier family 22 (organic anion transporter), member 8
    • Solute carrier family 22 member 8
    see all
  • Function
    Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA).
  • Tissue specificity
    Expressed in kidney.
  • Sequence similarities
    Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.
  • Cellular localization
    Basolateral cell membrane. Localizes on the brush border membrane of the choroid epithelial cells. Localizes to the basolateral membrane of the proximal tubular cells. Localizes on the abluminal and possibly, luminal membrane of the brain capillary endothelial cells (BCEC) (By similarity).
  • Information by UniProt

Images

  • ab160461 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up