Recombinant Human SLC23A1 protein (ab160742)

Overview

  • Product name
    Recombinant Human SLC23A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQ HYLTCFSGTIAVPFLLAEALCVGHDQHMVSQLIGTIFTCVGMFCTLFGMI TAVGLSNLQFVDMNSSRNLFALGFSMFFGLTLPNYLESNPGAINTGILEV DQILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSS SLKSYDFPIGMGIVKRITFLRYIPICPVFKGFSSSSKDQIAIPEDTPENT ETASVCTKV
    • Amino acids
      1 to 259
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hSVCT1
    • Na(+)/L-ascorbic acid transporter 1
    • S23A1_HUMAN
    • Slc23a1
    • Sodium-dependent vitamin C transporter 1
    • solute carrier family 23 (nucleobase transporters), member 1
    • Solute carrier family 23 member 1
    • SVCT1
    • Yolk sac permease-like molecule 3
    • YSPL3
    see all
  • Function
    Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
  • Tissue specificity
    Highly expressed in adult small intestine, kidney, thymus, ovary, colon, prostate and liver, and in fetal kidney, liver and thymus.
  • Sequence similarities
    Belongs to the xanthine/uracil permease family. Nucleobase:cation symporter-2 (NCS2) (TC 2.A.40) subfamily.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160742 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up