Recombinant Human SLC24A5 protein (ab166145)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQTKGGQTWARRALLLGILWATAHLPLSGTSLPQRLPRATGNSTQCVISP SSEFPEGFFTRQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISE SLGLSQDVAGTTFMAAGSSAPELVTAFLGVFITKGDIGISTILGSAIYNL LGICAACGLLSNTVSTLSCWPLFRDCAAYTISAAAVLGIIYDNQVYWYEG ALLLLIYGLYVLVLCFDIKINQYIIKKCSPCCACLAKAMERSEQQPLMGW EDEGQPFIRRQSRTDSGIFYEDSGYSQLSISLHGLSQVSEDPPSVFNMPE ADLKRIFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTY ILVWMVTITGETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAM SNIVGSNVFDMLCLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISII FLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGNNKIRGCGG
    • Amino acids
      1 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ion transporter JSX
    • JSX
    • Na(+)/K(+)/Ca(2+)-exchange protein 5
    • NCKX5
    • NCKX5_HUMAN
    • Slc24a5
    • Sodium/potassium/calcium exchanger 5
    • Solute carrier family 24 (sodium/potassium/calcium exchanger),member 5
    • Solute carrier family 24 member 5
    • Solute carrier family 24,member 5
    see all
  • Function
    Cation exchanger involved in pigmentation, possibly by participating in ion transport in melanosomes. Probably transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+).
  • Sequence similarities
    Belongs to the sodium/potassium/calcium exchanger family. SLC24A subfamily.
  • Cellular localization
    Membrane. Melanosome. Enriched in late-stage melanosomes.
  • Information by UniProt

Images

  • ab166145 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up