Recombinant Human SLC24A6 protein (ab153519)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPV VDCRKVCGLNVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAV TLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNG APDIFSALVAFSDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASR PFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWI YQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQET TAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKD DQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTA LASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVV FRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNIL VGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCF QLSRVYGFCLLLFYLNFLVVALLTEFGVIHLKSM
    • Amino acids
      1 to 584
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22233
    • Na(+)/K(+)/Ca(2+) exchange protein 6
    • Na(+)/K(+)/Ca(2+)-exchange protein 6
    • NCKX6
    • NCKX6_HUMAN
    • NCLX
    • Slc24a6
    • Sodium/potassium/calcium exchanger
    • Sodium/potassium/calcium exchanger 6
    • Solute carrier family 24 (sodium/potassium/calcium exchanger) member 6
    • Solute carrier family 24 member 6
    see all
  • Function
    Transports Ca(2+) in exchange for either Li(+) or Na(+), explaining how Li(+) catalyzes Ca(2+) exchange. In contrast to other members of the family its function is independent of K(+).
  • Sequence similarities
    Belongs to the sodium/potassium/calcium exchanger family. SLC24A subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153519 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up