Recombinant Human SLC25A11 protein (ab152863)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQ LSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLG IYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTAD GRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLA SYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNM RMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL EQMNKAYKRLFLSG
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 314

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • M2OM_HUMAN
    • Mitochondrial 2 oxoglutarate/malate carrier protein
    • Mitochondrial 2-oxoglutarate/malate carrier protein
    • OGC
    • OGCP
    • SLC20A4
    • SLC25A11
    • Solute carrier family 20 (oxoglutarate carrier) member 4
    • Solute carrier family 20 member 4
    • Solute carrier family 25 (mitochondrial carrier oxoglutarate carrier) member 11
    • Solute carrier family 25 member 11
    see all
  • Function
    Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152863 stained with Coomassie Blue.

References

ab152863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up