Recombinant Human SLC25A24 protein (ab162290)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRN LGIPLGQDAEEKIFTT
    • Amino acids
      1 to 66
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APC 1
    • APC1
    • Calcium binding mitochondrial carrier protein SCaMC 1
    • Calcium binding transporter
    • DKFZp586G0123
    • MCSC 1
    • MCSC1
    • Mitochondrial ATP Mg/Pi carrier protein 1
    • Mitochondrial ATP Mg/Pi transporter
    • Mitochondrial Ca(2+) dependent solute carrier protein 1
    • OTTHUMP00000012674
    • SCAMC 1
    • SCAMC1
    • Short calcium binding mitochondrial carrier 1
    • Slc25a24
    • Small calcium binding mitochondrial carrier protein 1
    • Solute carrier family 25 (mitochondrial carrier phosphate carrier) member 24
    • Solute carrier family 25 member 24
    see all
  • Relevance
    SLC25A24 (Solute carrier family 25 member 24) is a calcium-dependent mitochondrial solute carrier. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
  • Cellular localization
    Mitochondrion inner membrane; Multi-pass membrane protein

Images

  • ab162290 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up