Recombinant Human SLC25A25 protein (ab165033)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQ WKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDA QEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVEN IPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVS RTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINV LKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP MEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA GIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLAL VRTRMQAQASIEGAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAV SISYVVYENLKITLGVQSR
    • Amino acids
      1 to 469
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium-binding mitochondrial carrier protein SCaMC-2
    • KIAA1896
    • MCSC
    • MGC105138
    • MGC119514
    • MGC119515
    • MGC119516
    • MGC119517
    • Mitochondrial ATP Mg/Pi carrier
    • Mitochondrial ATP-Mg/Pi carrier protein 3
    • Mitochondrial Ca(2+)-dependent solute carrier protein 3
    • Mitochondrial Ca2+ dependent solute carrier
    • Mitochondrial calcium-dependent solute carrier
    • PCSCL
    • RP11 395P17.4
    • SCAMC 2
    • SCAMC2
    • SCMC2_HUMAN
    • Short calcium binding mitochondrial carrier 2
    • SLC25A25
    • Small calcium binding mitochondrial carrier 2
    • Small calcium-binding mitochondrial carrier protein 2
    • Solute carrier family 25 (mitochondrial carrier phosphate carrier) member 25
    • Solute carrier family 25 member 25
    • solute carrier family 25, member 25, isoform a
    see all
  • Function
    Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
  • Tissue specificity
    Present in various cell lines (at protein level). Widely expressed. Expressed in fetal and adult liver, skeletal muscle, testis, ovary, hippocampus and caudate nucleus. Isoform 1 is present in all tissues tested. Isoform 2 expression is restricted to kidney and lung.
  • Sequence similarities
    Belongs to the mitochondrial carrier (TC 2.A.29) family.
    Contains 3 EF-hand domains.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab165033 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up