Recombinant Human SLC25A3 protein (ab114679)

Overview

  • Product name
    Recombinant Human SLC25A3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAA VEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYK GIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNM LGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLR DAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERTVEALYKFVVP KPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASL VLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMP ESLKKKLGLTQ
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 361

Specifications

Our Abpromise guarantee covers the use of ab114679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • mitochondrial
    • Mitochondrial phosphate carrier protein
    • MPCP_HUMAN
    • OK/SW cl.48
    • PHC
    • Phosphate carrier protein
    • Phosphate carrier protein mitochondrial
    • Phosphate carrier protein mitochondrial precursor
    • Phosphate transport protein
    • PTP
    • Slc25a3
    • Solute carrier family 25 member 3
    • Solute carrier family 25 mitochondrial carrier phosphate carrier member 3
    see all
  • Function
    Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).
  • Involvement in disease
    Defects in SLC25A3 are a cause of mitochondrial phosphate carrier deficiency (MPCD) [MIM:610773]. MPCD is a fatal disorder of oxidative phosphorylation. Patients have lactic acidosis, hypertrophic cardiomyopathy and muscular hypotonia and die within the first year of life.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Recombinant Human SLC25A3 protein images

  • ab114679 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human SLC25A3 protein (ab114679)

ab114679 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up