Recombinant Human SLC25A33 protein (ab164549)

Overview

  • Product name
    Recombinant Human SLC25A33 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVY YPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVG VAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIW MVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISET IICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCI AYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIP NTAIVLSTYELIVYLLEDRTQ
    • Amino acids
      1 to 321
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BMSC MCP
    • BMSC-MCP
    • Bone marrow stromal cell mitochondrial carrier protein
    • HuBMSC MCP
    • HuBMSC-MCP
    • MGC4399
    • Mitochondrial carrier protein
    • Novel mitochondrial carrier protein
    • PNC1 protein
    • Protein PNC1
    • S2533_HUMAN
    • Slc25a33
    • Solute carrier family 25 member 33
    see all
  • Function
    Probable mitochondrial transporter which participates in dendritic cell endocytosis. May associate with mitochondrial oxidative phosphorylation.
  • Tissue specificity
    Expressed in the central nervous system. Also expressed in testis and skeletal muscle. Weakly expressed in heart, liver, kidney, prostate, colon and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab164549 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up