Recombinant Human SLC25A38 protein (ab162922)

Overview

  • Product name
    Recombinant Human SLC25A38 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDL LKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPG VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR YESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYN QTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPL KFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKM GLKS
    • Amino acids
      1 to 304
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20551
    • FLJ22703
    • S2538_HUMAN
    • slc25a38
    • Solute carrier family 25 member 38
    see all
  • Function
    Mitochondrial carrier required during erythropoiesis. Probably involved in the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.
  • Tissue specificity
    Preferentially expressed in erythroid cells.
  • Involvement in disease
    Anemia, sideroblastic, pyridoxine-refractory, autosomal recessive
  • Sequence similarities
    Belongs to the mitochondrial carrier (TC 2.A.29) family. SLC25A38 subfamily.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab162922 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up