Recombinant Human SLC25A6 protein (ab152180)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQ YKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFL GGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGT EREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKG MLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQFGRKGADIM YTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 298

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAC3
    • Adenine nucleotide translocator 3
    • ADP
    • ADP ATP carrier protein 3
    • ADP ATP carrier protein isoform T2
    • ADP ATP carrier protein liver
    • ADP/ATP translocase 3
    • ADP/ATP translocator of liver
    • ADT3_HUMAN
    • ANT
    • ANT 2
    • ANT 3
    • ANT3
    • ANT3Y
    • ATP carrier protein
    • ATP carrier protein 3
    • CDABP0051
    • isoform T2
    • MGC17525
    • SLC25A6
    • Solute carrier family 25 (mitochondrial carrier adenine nucleotide translocator) member 6
    • Solute carrier family 25 member 6
    see all
  • Function
    Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane. The complex formed with ARL2BP, ARL2 and SLC25A6 is expressed in mitochondria.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152180 stained with Coomassie Blue.

References

ab152180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up