Recombinant Human SLC26A3 protein (ab116818)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP40879
    • SpeciesHuman
    • SequenceTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFF RRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
    • Molecular weight36 kDa including tags
    • Amino acids503 to 600

Specifications

Our Abpromise guarantee covers the use of ab116818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Chloride anion exchanger
    • CLD
    • Congenital chloride diarrhea
    • Down regulated in adenoma
    • Down regulated in adenoma protein
    • Down-regulated in adenoma
    • DRA
    • Protein DRA
    • S26A3_HUMAN
    • SLC26A3
    • Solute carrier family 26 member 3
    see all
  • FunctionChloride/bicarbonate exchanger. Involved in absorbtion of in the colon. Helps mediate electrolyte and fluid absorption.
  • Involvement in diseaseDefects in SLC26A3 are the cause of diarrhea type 1 (DIAR1) [MIM:214700]; also known as congenital chloride diarrhea (CLD). DIAR1 is a disease characterized by voluminous watery stools containing an excess of chloride. The children with this disease are often premature.
  • Sequence similaritiesBelongs to the SLC26A/SulP transporter (TC 2.A.53) family.
    Contains 1 STAS domain.
  • Developmental stageExpression is significantly decreased in adenomas (polyps) and adenocarcinomas of the colon.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human SLC26A3 protein images

  • 12.5% SDS-PAGE showing ab116818 at approximately 36.41kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SLC26A3 protein (ab116818)

ab116818 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"