Recombinant Human SLC26A4 protein (ab116912)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVH DAILYLQNQVKSQEGQGSILETITLIQDCKD
    • Molecular weight
      35 kDa including tags
    • Amino acids
      674 to 754

Specifications

Our Abpromise guarantee covers the use of ab116912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • deafness, autosomal recessive 4
    • DFNB4
    • EVA
    • NSRD4
    • PDS
    • Pendred syndrome
    • Pendred syndrome homolog
    • Pendrin
    • S26A4_HUMAN
    • SLC26A4
    • Sodium independent chloride/iodide transporter
    • Sodium-independent chloride/iodide transporter
    • Solute carrier family 26 member 4
    see all
  • Function
    Sodium-independent transporter of chloride and iodide.
  • Tissue specificity
    High expression in adult thyroid, lower expression in adult and fetal kidney and fetal brain. Not expressed in other tissues.
  • Involvement in disease
    Pendred syndrome
    Deafness, autosomal recessive, 4
  • Sequence similarities
    Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.
    Contains 1 STAS domain.
  • Cellular localization
    Membrane. Cell membrane. Localizes to the apical brush border of cells in the cortical collecting ducts of the kidney.
  • Information by UniProt

Recombinant Human SLC26A4 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116912 at approximately 34.54 kDa.

References for Recombinant Human SLC26A4 protein (ab116912)

ab116912 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up