Recombinant Human SLC26A6 protein (ab163916)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSA PRTHQWRTWLQCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSV AIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRHISVGTFAVM SVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGL IHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIY TVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFT IAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSC SMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFHDLPKAVLAAIII VNLKGMLRQLSDMRSLWKANRADLLIWLVTFTATILLNLDLGLVVAVIFS LLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGVKVFRSSATVY FANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ AASPKGASVSINVNTSLEDMRSNNVEDCKMMVSSGDKMEDATANGQEDSK APDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEV EVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPD SPVSVTRL
    • Amino acids
      1 to 758
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anion exchange transporter
    • Anion transporter 1
    • DKFZp586E1422
    • Pendrin L1
    • Pendrin like protein 1
    • Pendrin-L1
    • Pendrin-like protein 1
    • S26A6_HUMAN
    • SLC26A6
    • Solute carrier family 26 member 6
    • Sulfate anion transporter
    see all
  • Function
    Does not seem to be involved in anion transport.
  • Tissue specificity
    Ubiquitous. Highest levels in kidney and pancreas. Lower expression in heart, skeletal muscle, liver and placenta. Also found in lung and brain.
  • Sequence similarities
    Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.
    Contains 1 STAS domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163916 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up